SOX17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SOX17 Polyclonal antibody, PBS Only (24903-1-PBS)

• 

  WB analysis using 24903-1-AP (same clone as 24903-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24903-1-AP (SOX17 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 24903-1-AP (same clone as 24903-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 24903-1-AP (SOX17 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24903-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SOX17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24903-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Transcription factor SOX-17, Transcription factor SOX 17

---

Product Information

24903-1-PBS targets SOX17 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19157

  Product name: Recombinant human SOX17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-66 aa of BC111365

  Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES

• Full Name: SRY (sex determining region Y)-box 17
• Calculated Molecular Weight: 414 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC111365
• Gene Symbol: SOX17
• Gene ID (NCBI): 64321
• RRID: AB_2879789
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6I2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transcription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder/bile duct formation (PMID: 19913509).