SP3 Recombinant monoclonal antibody

SP3 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85050-1-RR
Clone No.242556A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

242556A2, SPR 2, SPR-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, K-562 cells, PC-3 cells, HCT 116 cells, COLO 320 cells, C2C12 cells, C6 cells
Positive IHC detected inhuman ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85050-1-RR targets SP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25082

Product name: Recombinant human SP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 412-590 aa of BC126414

Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ

Predict reactive species
Full Name Sp3 transcription factor
Calculated Molecular Weight 781 aa, 82 kDa
Observed Molecular Weight70 kDa, 115 kDa
GenBank Accession NumberBC126414
Gene Symbol SP3
Gene ID (NCBI) 6670
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02447
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SP3, also named as transcription factor Sp3, is a 781 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the Sp1 C2H2-type zinc-finger protein family. SP3 localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. SP3 is acetylated by histone acetyltransferase p300, deacetylated by HDACs and sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. There exist tow modified isoform and molecular weight of those are 70 kda and 115 kda.

Protocols

Product Specific Protocols
IF protocol for SP3 antibody 85050-1-RRDownload protocol
WB protocol for SP3 antibody 85050-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...