Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated SP3 Recombinant monoclonal antibody

SP3 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-85050
Clone No.242556A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242556A2, SPR 2, SPR-2

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85050 targets SP3 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25082

Product name: Recombinant human SP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 412-590 aa of BC126414

Sequence: IVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQVTWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQ

Predict reactive species
Full Name Sp3 transcription factor
Calculated Molecular Weight 781 aa, 82 kDa
Observed Molecular Weight70 kDa, 115 kDa
GenBank Accession NumberBC126414
Gene Symbol SP3
Gene ID (NCBI) 6670
RRIDAB_3747715
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02447
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SP3, also named as transcription factor Sp3, is a 781 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the Sp1 C2H2-type zinc-finger protein family. SP3 localizes to the nuclear periphery and in nuclear dots when sumoylated. Some localization in PML nuclear bodies. SP3 is acetylated by histone acetyltransferase p300, deacetylated by HDACs and sumoylated on all isoforms. Sumoylated on 2 sites in longer isoforms with Lys-551 being the major site. Sumoylation at this site promotes nuclear localization to the nuclear periphery, nuclear dots and PML nuclear bodies. Sumoylation on Lys-551 represses the transactivation activity, except for the largest isoform, L-Sp3, which has little effect on transactivation. Alternate sumoylation and acetylation at Lys-551 also control transcriptional activity. There exist tow modified isoform and molecular weight of those are 70 kda and 115 kda.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SP3 antibody CL488-85050Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...