SPIRE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPIRE1 Polyclonal antibody, PBS Only (11295-1-PBS)

• 

  WB analysis using 11295-1-AP (same clone as 11295-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11295-1-AP (SPIRE1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11295-1-AP (same clone as 11295-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11295-1-AP (SPIRE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with . This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 11295-1-AP (same clone as 11295-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11295-1-AP (SPIRE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with . This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 11295-1-AP (same clone as 11295-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 11295-1-AP (SPIRE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 11295-1-AP (same clone as 11295-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SPIRE1 antibody (11295-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 11295-1-AP (same clone as 11295-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SPIRE1 antibody (11295-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11295-1-PBS in a different storage buffer formulation.

SPIRE1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 11295-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

KIAA1135, Protein spire homolog 1, Spir 1, SPIR1, Spir-1

---

Product Information

11295-1-PBS targets SPIRE1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1798

  Product name: Recombinant human SPIRE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 600-756 aa of BC016825

  Sequence: GRFSFFTWSYTCQFCKRPVCSQCCKKMRLPSKPYSTLPIFSLGPSALQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI

• Full Name: spire homolog 1 (Drosophila)
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 50-60 kDa, 95 kDa
• GenBank Accession Number: BC016825
• Gene Symbol: SPIRE1
• Gene ID (NCBI): 56907
• RRID: AB_3085370
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q08AE8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPIRE1, Protein spire homolog 1, belongs to the family of Wiskott-Aldrich homology region-2 (WH2) proteins (PMID: 11747823). SPIRE1 acts as an actin nucleation factor, associated with the slow-growing pointed end of the new filament (PMID: 11747823, PMID: 21620703). SPIRE1 and FMN2 promote assembly of nuclear actin filaments in response to DNA damage in order to facilitate movement of chromatin and repair factors after DNA damage (PMID: 26287480).