SPPL2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPPL2B Polyclonal antibody, PBS Only (27370-1-PBS)

• 

  WB analysis using 27370-1-AP (same clone as 27370-1-PBS)

  RT-4 cells were subjected to SDS PAGE followed by western blot with 27370-1-AP (SPPL2B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27370-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27370-1-AP (same clone as 27370-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27370-1-AP (SPPL2B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27370-1-PBS in a different storage buffer formulation.

SPPL2B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27370-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

IMP 4, IMP4, Intramembrane protease 4, KIAA1532, Presenilin like protein 1

---

Product Information

27370-1-PBS targets SPPL2B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25551

  Product name: Recombinant human SPPL2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-113 aa of BC028391

  Sequence: EGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGAR

• Full Name: signal peptide peptidase-like 2B
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC028391
• Gene Symbol: SPPL2B
• Gene ID (NCBI): 56928
• RRID: AB_3742228
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCT7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPPL2B (Signal Peptide Peptidase-Like 2B) is a multi-pass transmembrane aspartyl protease belonging to the GXGD family of intramembrane proteases. SPPL2B contains two conserved catalytic aspartate motifs localized within its membrane-spanning regions, similar to presenilins and γ-secretase. It localizes primarily to endosomes, lysosomes, and the plasma membrane, distinguishing it from ER-resident SPP and SPPL3. (PMID: 32052089, PMID: 19429495)