SPSB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SPSB1 Polyclonal antibody, PBS Only (12194-1-PBS)

• 

  WB analysis of Calu-1 using 12194-1-AP (same clone as 12194-1-PBS)

  WB result of SPSB1 antibody (12194-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPSB1 transfected Calu-1 cells. This data was developed using the same antibody clone with 12194-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 12194-1-AP (same clone as 12194-1-PBS)

  WB result of SPSB1 antibody (12194-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SPSB1 transfected K-562 cells. This data was developed using the same antibody clone with 12194-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12194-1-AP (same clone as 12194-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12194-1-AP (SPSB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12194-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SPSB1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12194-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

SPRY domain-containing SOCS box protein 1, SSB 1, SSB1, SSB-1

---

Product Information

12194-1-PBS targets SPSB1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2832

  Product name: Recombinant human SPSB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC015711

  Sequence: MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ

• Full Name: splA/ryanodine receptor domain and SOCS box containing 1
• Calculated Molecular Weight: 273 aa, 31 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC015711
• Gene Symbol: SPSB1
• Gene ID (NCBI): 80176
• RRID: AB_3741823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BD6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SPSB1, also known as Single-stranded DNA binding protein 1 (SSB1), is a member of the single-stranded DNA binding protein (SSB) family. It plays a pivotal role in the DNA damage response. As an early responder, SSB1 promptly associates with exposed single-strand DNA to shield it from degradation by various nucleases present in the cellular milieu.