• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SQLE Polyclonal antibody

SQLE Polyclonal Antibody for IF/ICC
Cat No. CL488-12544

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Squalene monooxygenase, squalene epoxidase, ERG1, EC:1.14.14.17

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12544 targets SQLE in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3266

Product name: Recombinant human SQLE protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 143-508 aa of BC017033

Sequence: SRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGLGDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAEPNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKVSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGGMTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGECVAGPVGL

Predict reactive species
Full Name squalene epoxidase
Calculated Molecular Weight 574 aa, 64 kDa
Observed Molecular Weight 50-64 kDa
GenBank Accession NumberBC017033
Gene Symbol SQLE
Gene ID (NCBI) 6713
RRIDAB_3672543
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14534
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SQLE, also named as ERG1, SE and SM, belongs to the squalene monooxygenase family. It catalyzes the first oxygenation step in cholesterol synthesis, acting on squalene before cyclization into the basic steroid structure. SQLE may serve as a flux-controlling enzyme beyond 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR, considered as rate limiting). It is also posttranslationally regulated by cholesterol-dependent proteasomal degradation. SQLE is subject to feedback regulation via cholesterol-induced degradation, which depends on its lipid-sensing N terminal regulatory domain. Truncation of SQLE occurs during its endoplasmic reticulum-associated degradation and requires the proteasome, which partially degrades the SQLE N-terminus and eliminates cholesterol-sensing elements within this region. The MW of SQLE is about 50-64 kDa. (PMID:21356516, PMID: 28972164)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SQLE antibody CL488-12544Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...