SQRDL Polyclonal antibody, PBS Only

• 

  WB analysis using 17256-1-AP (same clone as 17256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17256-1-AP (SQRDL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17256-1-AP (same clone as 17256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17256-1-AP (SQRDL antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 17256-1-AP (same clone as 17256-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 17256-1-AP (SQRDL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 17256-1-AP (same clone as 17256-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 17256-1-AP (SQRDL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 17256-1-AP (same clone as 17256-1-PBS)

  IP result of anti-SQRDL (IP:17256-1-AP, 4ug; Detection:17256-1-AP 1:500) with HeLa cells lysate 2000ug. This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 17256-1-AP (SQRDL antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17256-1-AP (SQRDL antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 17256-1-AP (SQRDL antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat liver using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 17256-1-AP (SQRDL antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17256-1-AP (SQRDL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17256-1-AP (same clone as 17256-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17256-1-AP (SQRDL antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17256-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SQRDL Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17256-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CGI 44, CGI-44, EC:1.8.5.8, SQOR, Sulfide dehydrogenase-like

---

Product Information

17256-1-PBS targets SQRDL in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10762

  Product name: Recombinant human SQRDL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 100-450 aa of BC016836

  Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

• Full Name: sulfide quinone reductase-like (yeast)
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC016836
• Gene Symbol: SQRDL
• Gene ID (NCBI): 58472
• RRID: AB_2195894
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6N5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SQRDL(Sulfide:quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.Although the SQRDL precursor protein displays a molecular weight of 50 kDa,a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria(PMID:22067608).SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells.