SRA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SRA1 Polyclonal antibody (24655-1-AP)

SRA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24655-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

PP7684, SRAP, Steroid receptor RNA activator 1, Steroid receptor RNA activator protein

• 

  WB analysis of A2780 using 24655-1-AP

  A2780 cells were subjected to SDS PAGE followed by western blot with 24655-1-AP (SRA1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 24655-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24655-1-AP (SRA1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24655-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24655-1-AP (SRA1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24655-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24655-1-AP (SRA1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 24655-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24655-1-AP (SRA1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 24655-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 24655-1-AP (SRA1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 24655-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SRA1 antibody (24655-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 24655-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug SRA1 Polyclonal antibody (24655-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SRA1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A2780 cells, HEK-293 cells
• Positive IHC detected in: human breast cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24655-1-AP targets SRA1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20082

  Product name: Recombinant human SRA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-209 aa of BC067895

  Sequence: GNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLF

• Full Name: steroid receptor RNA activator 1
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 30 kDa, 33 kDa
• GenBank Accession Number: BC067895
• Gene Symbol: SRA1
• Gene ID (NCBI): 10011
• RRID: AB_2879657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HD15
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Steroid receptor RNA activator 1 (SRA1), also known as seroid receptor RNA activator protein (SRAP) or SRA, is involved in modulating the activity of multiple transcription factors including the estrogen receptor (ER) (PMID: 20398657). It may play a role in tumorigenesis (PMID: 16152589). The SRA1 gene encodes both SRA1 protein and a non-coding functional RNA that functions as part of a ribonucleoprotein complex activating steroid receptor induced transcription. This polyclonal antibody recognizes endogenous SRA1 isoforms which migrate as a doublet on SDS-PAGE gels (PMID: 12565891; 23907597).

Publications

What published studies show

The SRA1 Polyclonal antibody (Cat# 24655-1-AP) has 14 citations published in journals including Advanced Science, Phytomedicine, Arteriosclerosis, Thrombosis and Vascular Biology, Free Radical Biology and Medicine, Journal of Investigative Dermatology, Journal of Ethnopharmacology, RSC Advances, Frontiers in Pharmacology, Journal of Lipid Research, Journal of Biological Chemistry, PLoS ONE, and bioRxiv. Research fields span atherosclerosis, macrophage biology, lipid/cholesterol metabolism, foam cell formation, ferroptosis, and tumor-associated macrophages.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); Pyruvate Carboxylase in Macrophages Aggravates Atherosclerosis by Regulating Metabolism Reprogramming to Promote Inflammatory Responses Through the Hypoxia-Inducible Factor-1 Signaling Pathway; Authors - Ling-Na Zhao
mouse,human	WB	Phytomedicine; Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux; Authors - Jianfei Mu
mouse	WB	Arterioscler Thromb Vasc Biol; Macrophage PIM1 Drives Atherosclerosis by Enhancing Foam Cell Formation Via CD36.; Authors - Mirza Ahmar Beg
mouse,human	WB	Arterioscler Thromb Vasc Biol; RP5-833A20.1/miR-382-5p/NFIA-Dependent Signal Transduction Pathway Contributes to the Regulation of Cholesterol Homeostasis and Inflammatory Reaction.; Authors - Yan-Wei Hu
mouse	WB	Free Radic Biol Med; Up-regulation of thioredoxin system by puerarin inhibits lipid uptake in macrophages; Authors - Wenchao Li,
		J Invest Dermatol; Heat shock protein 70/toll-like receptor 2 orchestrates melanocyte ferroptosis in the onset of vitiligo.; Authors - Xiaoxue Xing