CoraLite®594-conjugated SRD5A1 Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66329

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CL594-66329 (SRD5A1 antibody) at dilution of 1:100.

• Featured Product
• KD/KO Validated

SRD5A1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66329

Clone No.1D5D8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

S5AR 1, SR type 1, SRD5A1, Steroid 5 alpha reductase 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66329 targets SRD5A1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23351

  Product name: Recombinant human SRD5A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC007033

  Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGML

• Full Name: steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC007033
• Gene Symbol: SRD5A1
• Gene ID (NCBI): 6715
• RRID: AB_2883559
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P18405
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

SRD5A1 is a minor component of the reductase activity in prostate although the gene was originally cloned from prostate. On the other hand, SRD5A1 appears to be the predominant isozyme of steroid 5-alpha-reductase in the scalp and elsewhere in the skin.