• Featured Product
  • KD/KO Validated

SREBF1 Monoclonal antibody

SREBF1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66875-1-Ig
Clone No.1B6G5

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

SREBP 1, SREBF 1, Processed sterol regulatory element-binding protein 1, Class D basic helix-loop-helix protein 1, bHLHd1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HeLa cells, Jurkat cells, HT-29 cells, L02 cells, A549 cells, MOLT-4 cells
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66875-1-Ig targets SREBF1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5484

Product name: Recombinant human SREBF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-332 aa of BC063281

Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK

Predict reactive species
Full Name sterol regulatory element binding transcription factor 1
Calculated Molecular Weight 1177 aa, 125 kDa
Observed Molecular Weight 125 kDa
GenBank Accession NumberBC063281
Gene Symbol SREBF1
Gene ID (NCBI) 6720
RRIDAB_2882209
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP36956
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125kd precursor form and the 68kd mature form of human SREBF1.

Protocols

Product Specific Protocols
WB protocol for SREBF1 antibody 66875-1-IgDownload protocol
IHC protocol for SREBF1 antibody 66875-1-IgDownload protocol
IF protocol for SREBF1 antibody 66875-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Metab

TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.

Authors - Dong Huang

J Hepatol

OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism.

Authors - Weiqi Dai
humanWB

Nat Commun

Pharmacological inhibition of Lin28 promotes ketogenesis and restores lipid homeostasis in models of non-alcoholic fatty liver disease

Authors - Evangelia Lekka
WB,IF

Phytomedicine

Wen-Shen-Jian-Pi-Hua-Tan decoction protects against early obesity-related glomerulopathy by improving renal bile acid composition and suppressing lipogenesis, inflammation, and fibrosis

Authors - Daofei Song
humanWB

Phytomedicine

Asperosaponin VI protects alcohol-induced hepatic steatosis and injury via regulating lipid metabolism and ER stress

Authors - Linlin Wei
human,WB

J Hazard Mater

In vitro effects of Triclocarban on adipogenesis in murine preadipocyte and human hepatocyte.

Authors - Manyuan Dong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Iram (Verified Customer) (08-14-2020)

we saw very clean staining of SREBF1 in our tissue sections.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:1000 for western and 1:100 for IHC
  • Cell Tissue Type: Human colon cancer cells
FH

Miray (Verified Customer) (11-25-2019)

it works well for the liver lysate isolated from mice liver.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver
SREBF1 Antibody Western Blot, validation (1:1000 dilution) in Liver (Cat no:66875-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...