Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, Jurkat cells, HT-29 cells, L02 cells, A549 cells, MOLT-4 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66875-1-Ig targets SREBF1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5484 Product name: Recombinant human SREBF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-332 aa of BC063281 Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK Predict reactive species |
| Full Name | sterol regulatory element binding transcription factor 1 |
| Calculated Molecular Weight | 1177 aa, 125 kDa |
| Observed Molecular Weight | 125 kDa |
| GenBank Accession Number | BC063281 |
| Gene Symbol | SREBF1 |
| Gene ID (NCBI) | 6720 |
| RRID | AB_2882209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P36956 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125kd precursor form and the 68kd mature form of human SREBF1.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| IHC protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| WB protocol for SREBF1 antibody 66875-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
SREBP1 antibody (Cat# 66875-1-Ig) has accumulated 79 citations across 60+ journals, including Nature Communications, Cell Metabolism, Journal of Hepatology, Oncogene, Diabetes, and Phytomedicine. Key research fields include lipid metabolism, NAFLD and obesity, multiple cancer types (hepatocellular, breast, pancreatic, ovarian, melanoma, gastric, prostate, colorectal, lung), ferroptosis, insulin resistance, inflammation, cardiology, neurology, rheumatology, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
J Hepatol OGDHL silencing promotes hepatocellular carcinoma by reprogramming glutamine metabolism. | ||
Cell Metab TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis. | ||
Nat Commun SREBP1-mediated lipogenesis promotes dedifferentiation and senescence of vascular smooth muscle cells through epigenetic remodeling.
| ||
Nat Commun Pharmacological inhibition of Lin28 promotes ketogenesis and restores lipid homeostasis in models of non-alcoholic fatty liver disease | ||
Nucleic Acids Res FOXN3 integrates the KU70/KU80/SREBP-1 complex to regulate lipid metabolism in non-alcoholic fatty liver disease. | ||
Adv Sci (Weinh) Platelet-Derived Growth Factor C Facilitates Malignant Behavior of Pancreatic Ductal Adenocarcinoma by Regulating SREBP1 Mediated Lipid Metabolism |
Reviews
What customers say
Both reviewers gave this SREBF1 antibody a perfect 5-star rating. One user reported very clean staining in human colon cancer tissue sections using 1:100 dilution for IHC and 1:1000 for Western blot. The other confirmed strong performance on mouse liver lysates at 1:1000 for Western blot. Overall, users are satisfied with the antibody's specificity and performance across both WB and IHC applications in human and mouse samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Iram (Verified Customer) (08-14-2020) | we saw very clean staining of SREBF1 in our tissue sections.
|
Miray (Verified Customer) (11-25-2019) | it works well for the liver lysate isolated from mice liver.
 |
