Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated SRP54 Monoclonal antibody

SRP54 Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67005
Clone No.1D6D1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

1D6D1, EC:3.6.5.4, SCN8, Signal recognition particle subunit SRP54

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67005 targets SRP54 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12166

Product name: Recombinant human SRP54 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 167-505 aa of BC003389

Sequence: DPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQGAAGNMKGMMGFNNM

Predict reactive species
Full Name signal recognition particle 54kDa
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC003389
Gene Symbol SRP54
Gene ID (NCBI) 6729
RRIDAB_3672934
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61011
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The signal recognition particle (SRP) is a ribonucleoprotein complex that mediates the targeting of proteins to the endoplasmic reticulum (ER). The complex consists of a 7S (or 7SL) RNA and 6 different proteins, and signal recognition particle 54 (SRP54) is one of them. SRP54 binds to the signal sequence of presecretory protein as they emerge from the translating ribosomes, and then transfers them to translocating chain-associating membrane protein (TRAM).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SRP54 antibody CL488-67005Download protocol
IF protocol for CL Plus 488 SRP54 antibody CL488-67005Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...