CoraLite®594-conjugated IL-1RL1/ST2 Polyclonal antibody

IL-1RL1/ST2 Polyclonal Antibody for FC (Intra)
Cat No. CL594-30194

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IL1RL1, DER4, EC:3.2.2.6, FIT 1, IL-1RL1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-30194 targets IL-1RL1/ST2 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg0116

Product name: Recombinant Human ST2/IL-1 RL1 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 19-328 aa of BC030975

Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF

Predict reactive species
Full Name interleukin 1 receptor-like 1
Calculated Molecular Weight 63 kDa, 37 kDa, 30 kDa
GenBank Accession NumberBC030975
Gene Symbol IL1RL1
Gene ID (NCBI) 9173
RRIDAB_3673431
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01638
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ST2, also known as IL1RL1, is a member of the IL-1 superfamily and serves as the receptor for IL-33. It plays a major role in immune and inflammatory responses. ST2 is expressed by various types of immune cells including Th2 cells, mast cells, type 2 innate lymphoid cells, eosinophils, basophils, NK cells, and non-immune cells, including cardiomyocytes. Two forms of ST2 exist: a membrane-bound form and a soluble form (sST2). The membrane-bound form activates the MyD88/NF-κB signaling pathway to enhance mast cell, Th2, regulatory T cell (Treg), and innate lymphoid cell type 2 functions. sST2 acts as a decoy receptor. (PMID: 27055914; 23999434; 28484466)

Protocols

Product Specific Protocols
FC protocol for CL594 IL-1RL1/ST2 antibody CL594-30194Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...