STARD7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85131-4-RR (same clone as 85131-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85131-4-RR (STARD7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85131-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 85131-4-RR (same clone as 85131-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85131-4-RR (STARD7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85131-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 85131-4-RR (same clone as 85131-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85131-4-RR (STARD7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85131-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 85131-4-RR (same clone as 85131-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85131-4-RR (STARD7 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85131-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85131-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85131-4-RR against Human STARD7 were performed. The affinity constant is below 1 pM.

STARD7 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85131-4-PBS

Clone No.242760A3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

242760A3, GTT1, StAR-related lipid transfer protein 7, mitochondrial, START domain-containing protein 7

---

Product Information

85131-4-PBS targets STARD7 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8224

  Product name: Recombinant human STARD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-295 aa of BC008894

  Sequence: MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA

• Full Name: StAR-related lipid transfer (START) domain containing 7
• Calculated Molecular Weight: 295 aa, 35 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008894
• Gene Symbol: STARD7
• Gene ID (NCBI): 56910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NQZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STARD7, also known as gestational trophoblastic tumor gene-1 (GTT1), is a lipid transfer protein that specifically binds and transports phosphatidylcholine (PC) between cellular membranes. It is a member of the START (Steroidogenic Acute Regulatory protein-related lipid transfer) domain-containing protein family, which is involved in intracellular lipid transport and metabolism. (PMID: 23507753)