STBD1 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67018-1-Ig (same clone as 67018-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67018-1-Ig (STBD1 antibody) at dilution of 1:16000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67018-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67018-1-Ig (same clone as 67018-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67018-1-Ig (STBD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67018-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67018-1-Ig (same clone as 67018-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67018-1-Ig (STBD1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67018-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67018-1-Ig (same clone as 67018-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using STBD1 antibody (67018-1-Ig, Clone: 1A2G2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67018-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50130-2

  Cytometric bead array standard curve of MP50130-2, STBD1 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67018-1-PBS. Detection antibody: 67018-2-PBS. Standard:Ag28613. Range: 1.563-100 ng/mL.

STBD1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67018-1-PBS

Clone No.1A2G2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

1A2G2, Genethonin-1, GENX-3414, Glycophagy cargo receptor STBD1, starch binding domain 1

---

Product Information

67018-1-PBS targets STBD1 as part of a matched antibody pair:

MP50130-2: 67018-1-PBS capture and 67018-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28613

  Product name: Recombinant human STBD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-358 aa of BC022301

  Sequence: GPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVGGSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAVTGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH

• Full Name: starch binding domain 1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC022301
• Gene Symbol: STBD1
• Gene ID (NCBI): 8987
• RRID: AB_2882334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95210
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STBD1 may have the capability to bind to carbohydrates. It functions as a glycogen receptor that tethers glycogen to autophagic membranes for delivery and breakdown in lysosomes. STBD1 appears molecular mass of 35-38 kDa band in mouse/rat tissues and 38-43 kDa in human tissue.