Tested Applications
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | NIH/3T3 cells |
| Positive FC (Intra) detected in | Daudi cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-83081-2 targets STK39 in IF/ICC, IF-P applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34503 Product name: Recombinant human STK39 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 396-455 aa of BC166614 Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV Predict reactive species |
| Full Name | serine threonine kinase 39 (STE20/SPS1 homolog, yeast) |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC166614 |
| Gene Symbol | STK39 |
| Gene ID (NCBI) | 27347 |
| RRID | AB_3747358 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UEW8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 STK39 antibody CL488-83081-2 | Download protocol |
| IF protocol for CL Plus 488 STK39 antibody CL488-83081-2 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





