• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated STK39 Recombinant monoclonal antibody

STK39 Uni-rAb® Recombinant Antibody for IF/ICC, IF-P
Cat No. CL488-83081-2
Clone No.230382G9

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, IF-P

230382G9, DCHT, PASK, SPAK, Ste 20 related kinase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inDaudi cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83081-2 targets STK39 in IF/ICC, IF-P applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34503

Product name: Recombinant human STK39 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 396-455 aa of BC166614

Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV

Predict reactive species
Full Name serine threonine kinase 39 (STE20/SPS1 homolog, yeast)
Calculated Molecular Weight59 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberBC166614
Gene Symbol STK39
Gene ID (NCBI) 27347
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UEW8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 STK39 antibody CL488-83081-2Download protocol
IF protocol for CL Plus 488 STK39 antibody CL488-83081-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...