STUB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• STUB1 Polyclonal antibody, PBS Only (29751-1-PBS)

• 

  WB analysis using 29751-1-AP (same clone as 29751-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29751-1-AP (STUB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 29751-1-AP (same clone as 29751-1-PBS)

  WB result of STUB1 antibody (29751-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-STUB1 transfected HeLa cells. This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 29751-1-AP (same clone as 29751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29751-1-AP (STUB1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 29751-1-AP (same clone as 29751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29751-1-AP (STUB1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 29751-1-AP (same clone as 29751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 29751-1-AP (STUB1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 29751-1-AP (same clone as 29751-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 29751-1-AP (STUB1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29751-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

STUB1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29751-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CHIP, Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP

---

Product Information

29751-1-PBS targets STUB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31335

  Product name: Recombinant human STUB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 73-303 aa of BC007545

  Sequence: MQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

• Full Name: STIP1 homology and U-box containing protein 1
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC007545
• Gene Symbol: STUB1
• Gene ID (NCBI): 10273
• RRID: AB_2923603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNE7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

STUB1, also named as CHIP, SDCCAG7, UBOX1 and NY-CO-7, is a E3 ubiquitin-protein ligase which targets misfolded chaperone substrates towards proteasomal degradation. STUB1/CHIP modulates the activity of several chaperone complexes, including Hsp70, Hsc70 and Hsp90. It mediates transfer of non-canonical short ubiquitin chains to HSPA8 that have no effect on HSPA8 degradation. STUB1/CHIP mediates polyubiquitination of CYP3A4.(PMID:10330192) CHIP/STUB1 strongly reduced keratin aggregates through increased degradation of mutant K14. (PMID:20151404) STUB1/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer patients.(PMID:21220432 )