SVEP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SVEP1 Polyclonal antibody, PBS Only (31030-1-PBS)

• 

  WB analysis using 31030-1-AP (same clone as 31030-1-PBS)

  Various lysates were subjected to Tris-acetate followed by western blot with 31030-1-AP (SVEP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31030-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31030-1-AP (same clone as 31030-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31030-1-AP (SVEP1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31030-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31030-1-AP (same clone as 31030-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31030-1-AP (SVEP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31030-1-PBS in a different storage buffer formulation.

SVEP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31030-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C9orf13, CCP22, POLYDOM, SEL OB, SELOB

---

Product Information

31030-1-PBS targets SVEP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34316

  Product name: Recombinant human SVEP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 736-900 aa of NM_153366

  Sequence: GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLGKMVPSFCSDAEDIDCRLEENLTKKYCLEYNYDYENGFAIGPGGWGAANRLDYSYDDFLDTVQETATSIGNAKS

• Full Name: sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
• Calculated Molecular Weight: 390 kDa
• Observed Molecular Weight: 460 kDa
• GenBank Accession Number: NM_153366
• Gene Symbol: SVEP1
• Gene ID (NCBI): 79987
• RRID: AB_3742391
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q4LDE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SVEP1 (C9orf13), which is predicted to be located in the cell membrane, nucleus and cytoplasm. The protein is expressed in the whole epidermis, especially in the basal layer of epidermis, the upper and lower layers of basal layer and dermal fibroblasts in the upper dermis (PMID:27892606). At the same time, it is highly expressed in placenta, lung, adrenal gland and cerebellum, but weakly expressed in heart and skeletal muscle (PMID:11062057, PMID:27892606). The molecular weight of SVEP1 is 390 kDa. At the same time, it also has several isomers of 96kDa, 163kDa and 170kDa, and there are also glycosylation modifications. It is reported that the molecular weight is 460 kDa (PMID: 32371982). The protein may plays a role in initial cell attachment of stromal osteogenic cells.