CoraLite®594-conjugated Sam50 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-67425

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®594-conjugated Sam50 antibody (CL594-67425, Clone: 2H6H9 ) at dilution of 1:100.

Sam50 Monoclonal Antibody for IF/ICC

Cat No. CL594-67425

Clone No.2H6H9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Rat, Mouse

Applications

IF/ICC

Synonyms

CGI 51, FLJ35825, FLJ42905, FLJ99036, OMP85, SAM50, SAMM50, TOB55, TRG 3, TRG3, YNL026W

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67425 targets Sam50 in IF/ICC applications and shows reactivity with Human, Pig, Rat, Mouse samples.

• Tested Reactivity: Human, Pig, Rat, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15155

  Product name: Recombinant human SAMM50 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 119-468 aa of BC007830

  Sequence: TFEVTELRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL

• Full Name: sorting and assembly machinery component 50 homolog (S. cerevisiae)
• Calculated Molecular Weight: 469 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC007830
• Gene Symbol: Sam50
• Gene ID (NCBI): 25813
• RRID: AB_2920133
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y512
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Sam50, encoded by the SAMM50 gene, is an essential protein of the mitochondrial outer membrane (OMM). It contains a beta-barrel domain conserved from bacteria to man (PMID: 14570913). Sam50 is a part of the sorting and assembly machinery (SAM) necessary for the assembly of beta-barrel proteins in the OMM (PMID: 22252321). It is crucial for maintaining mitochondrial shape, morphology of mitochondrial cristae, and assembly of the mitochondrial respiratory chain complexes (PMID: 26587038; 22252321; 25781180). Polymorphisms in the SAMM50 gene have been associated with development and progression of nonalcoholic fatty liver disease (PMID: 23535911).