CoraLite®594-conjugated Sam50 Monoclonal antibody

Sam50 Monoclonal Antibody for IF/ICC

Cat No. CL594-67425
Clone No.2H6H9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Rat, Mouse

Applications

IF/ICC

CGI 51, FLJ35825, FLJ42905, FLJ99036, OMP85, SAM50, SAMM50, TOB55, TRG 3, TRG3, YNL026W

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67425 targets Sam50 in IF/ICC applications and shows reactivity with Human, Pig, Rat, Mouse samples.

Tested Reactivity Human, Pig, Rat, Mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15155

Product name: Recombinant human SAMM50 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 119-468 aa of BC007830

Sequence: TFEVTELRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSMHSIGPQSEGDYLGGEAYWAGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL

Predict reactive species
Full Name sorting and assembly machinery component 50 homolog (S. cerevisiae)
Calculated Molecular Weight 469 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC007830
Gene Symbol Sam50
Gene ID (NCBI) 25813
RRIDAB_2920133
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y512
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Sam50, encoded by the SAMM50 gene, is an essential protein of the mitochondrial outer membrane (OMM). It contains a beta-barrel domain conserved from bacteria to man (PMID: 14570913). Sam50 is a part of the sorting and assembly machinery (SAM) necessary for the assembly of beta-barrel proteins in the OMM (PMID: 22252321). It is crucial for maintaining mitochondrial shape, morphology of mitochondrial cristae, and assembly of the mitochondrial respiratory chain complexes (PMID: 26587038; 22252321; 25781180). Polymorphisms in the SAMM50 gene have been associated with development and progression of nonalcoholic fatty liver disease (PMID: 23535911).

Protocols

Product Specific Protocols
IF protocol for CL594 Sam50 antibody CL594-67425Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...