Sam68 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Sam68 Polyclonal antibody, PBS Only (10222-1-PBS)

• 

  WB analysis using 10222-1-AP (same clone as 10222-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10222-1-AP (Sam68 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10222-1-AP (same clone as 10222-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10222-1-AP (Sam68 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 10222-1-AP (same clone as 10222-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10222-1-AP (KHDRBS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10222-1-AP (same clone as 10222-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10222-1-AP (KHDRBS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 10222-1-AP (same clone as 10222-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10222-1-AP (KHDRBS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10222-1-AP (same clone as 10222-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10222-1-AP (KHDRBS1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 10222-1-AP (same clone as 10222-1-PBS)

  IP result of anti-Sam68 (IP:10222-1-AP, 4ug; Detection:10222-1-AP 1:1000) with HeLa cells lysate 1200ug. This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 10222-1-AP (same clone as 10222-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10222-1-AP (Sam68 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 10222-1-AP (same clone as 10222-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10222-1-AP (Sam68 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 10222-1-AP (same clone as 10222-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10222-1-AP (Sam68 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10222-1-AP (same clone as 10222-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Sam68 antibody (10222-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 10222-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Sam68 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10222-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

KHDRBS1, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, KHDRBS 1, p21 Ras GTPase-activating protein-associated p62

---

Product Information

10222-1-PBS targets Sam68 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0235

  Product name: Recombinant human Sam68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-442 aa of BC000717

  Sequence: GSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGR

• Full Name: KH domain containing, RNA binding, signal transduction associated 1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC000717
• Gene Symbol: Sam68
• Gene ID (NCBI): 10657
• RRID: AB_2130292
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KHDRBS1, also named as SAM68, p62and p68, belongs to the KHDRBS family. It is recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and INS receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export. KHDRBS1 has three isoforms with calculated MW of 44-48kd. For isoform with a calculated MW of 48.2 kD, it migrated as a 68kD protein on SDS-PAGE gels[PMID: 10564820]. This ia a rabbit polyclonal antibody raised against residues near the N terminus of human Sam68.