• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Stathmin 1 Polyclonal antibody

Stathmin 1 Polyclonal Antibody for FC (Intra)
Cat No. CL488-11157

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

STMN1, C1orf215, LAP18, Leukemia-associated phosphoprotein p18, OP18

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11157 targets Stathmin 1 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1633

Product name: Recombinant human STMN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-149 aa of BC014353

Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Predict reactive species
Full Name stathmin 1/oncoprotein 18
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC014353
Gene Symbol Stathmin 1
Gene ID (NCBI) 3925
RRIDAB_3672485
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16949
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Stathmin 1 (STMN1) normally regulates microtubule dynamics either by sequestering free tubulin heterodimers or by promoting microtubule catastrophe. STMN1 is highly expressed in fetal and adult brain, spinal cord, and cerebellum. Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. Phosphorylation of stathmin is involved in response to NGF, neuron polarization and microtubule polymerization inhibition activity. Increased expression of STMN1 has been observed in a variety of human malignancies, such as colorectal primary tumors and metastatic tissues, but its association with melanoma is so far not well known.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Stathmin 1 antibody CL488-11157Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...