CoraLite® Plus 488-conjugated SHOC2/Sur-8 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-17561

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 Sur-8 antibody (CL488-17561) at dilution of 1:200, CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

SHOC2/Sur-8 Polyclonal Antibody for IF/ICC

Cat No. CL488-17561

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

SHOC2, Sur-8, Protein sur-8 homolog, Protein sur 8 homolog, Protein soc-2 homolog

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17561 targets SHOC2/Sur-8 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11754

  Product name: Recombinant human SHOC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 235-583 aa of BC050445

  Sequence: GELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLKMQGPYRAMV

• Full Name: soc-2 suppressor of clear homolog (C. elegans)
• Calculated Molecular Weight: 582 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC050445
• Gene Symbol: SHOC2/Sur-8
• Gene ID (NCBI): 8036
• RRID: AB_3672675
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQ13
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.