Mouse Surfactant protein D Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85985-1-RR (same clone as 85985-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85985-1-RR (Sftpd antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP02322-1

  Sandwich ELISA standard curve of MP02322-1, Mouse Surfactant protein D Recombinant Matched Antibody Pair - PBS only. 85985-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2924. 85985-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP02322-1

  The mean Surfactant protein D concentration was determined to be 47.1 ng/mL in mouse lung tissue extract based on a 5.3 mg/mL extract load.

• 

  Sample test of MP02322-1

  Mouse lung, cut into 1-2 mm pieces, was cultured unstimulated or stimulated with 1 μg/mL LPS for 3 days. The mean Surfactant protein D concentration was undetectable in unstimulated supernatant, 7.4 ng/mL in LPS stimulated supernatant.

• 

  Sample test of MP02322-1

  Serum of sixteen mice was measured. The Surfactant protein D concentration of detected samples was determined to be 293.4 pg/mL with a range of 164.4-696.5 pg/mL.

• 

  IP experiment of mouse lung using 85985-1-RR (same clone as 85985-1-PBS)

  IP result of anti-Surfactant protein D (IP:85985-1-RR, 4ug; Detection:85985-1-RR 1:3000) with mouse lung tissue lysate 1760 ug. This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 85985-1-RR (same clone as 85985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 85985-1-RR (same clone as 85985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 85985-1-RR (same clone as 85985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 85985-1-RR (same clone as 85985-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85985-1-RR (Surfactant protein D antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85985-1-PBS in a different storage buffer formulation.

Surfactant protein D Uni-rAb^® Recombinant Antibody for WB, IHC, IP, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85985-1-PBS

Clone No.250571G8

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IP, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Lung surfactant protein D, PSP-D, Pulmonary surfactant-associated protein D, Sftp4, Sftpd

---

Product Information

85985-1-PBS targets Surfactant protein D as part of a matched antibody pair:

MP02322-1: 85985-1-PBS capture and 85985-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2924

  Product name: Recombinant Mouse Surfactant protein D protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-374 aa of NM_009160.2

  Sequence: AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

• Full Name: surfactant associated protein D
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_009160.2
• Gene Symbol: Sftpd
• Gene ID (NCBI): 20390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50404
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Surfactant protein D (SP-D) is a pattern recognition molecule of the collectin family of C-type lectins, which consist of four structural domains: a cysteine-rich N-terminal domain, a collagen-like region, an alpha-helical coiled-coil neck domain and a C-terminal lectin or carbohydrate-recognition domain (PMID: 16213021; 15030473). SP-D is primarily expressed and secreted by type II alveolar cells (PMID: 16684127). It plays a central role in the pulmonary host defence and the modulation of allergic responses.