transgelin/SM22 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• transgelin/SM22 Monoclonal antibody (60213-1-Ig)

transgelin/SM22 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60213-1-Ig

Clone No.2A10C2

Publications(39)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, ELISA

Synonyms

SM22, transgelin, 22 kDa actin-binding protein, 2A10C2, Protein WS3-10

• 

  WB analysis using 60213-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 60213-1-Ig

  human colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60213-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig stomach using 60213-1-Ig

  pig stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat colon using 60213-1-Ig

  rat colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat stomach using 60213-1-Ig

  rat stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human stomach using 60213-1-Ig

  human stomach tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 60213-1-Ig

  human colon tissue were subjected to SDS PAGE followed by western blot with 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60213-1-Ig (transgelin/SM22 antibody at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60213-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 60213-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using transgelin/SM22 antibody (60213-1-Ig, Clone: 2A10C2 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 60213-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse heart using 60213-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 60213-1-Ig (transgelin/SM22 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: pig colon tissue, human colon tissue, pig stomach tissue, human stomach tissue, rat colon tissue, rat stomach tissue, rabbit stomach tissue, mouse colon tissue
• Positive IHC detected in: human colon tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:400
• Immunofluorescence (IF)-P: IF-P : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60213-1-Ig targets transgelin/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0764

  Product name: Recombinant human TAGLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC004927

  Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

• Full Name: transgelin
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 18+22 kDa
• GenBank Accession Number: BC004927
• Gene Symbol: transgelin/SM22
• Gene ID (NCBI): 6876
• RRID: AB_11043177
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q01995
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Nat Commun; Improving erectile function in diabetic male mice by rescuing depalmitoylated FBP1 to reduce cavernosal lactate.; Authors - Ming Xiao
		Nat Commun; Perivascular adipose single-cell atlas identifies CD55(+) adipose-derived stem cells as vascular remodeling regulators in atherosclerosis.; Authors - Junye Chen
rat,mouse	WB	Circ Res; LncRNA PSR Regulates Vascular Remodeling Through Encoding a Novel Protein Arteridin; Authors - Junyi Yu
mouse	WB	J Adv Res; Cytoskeletal-related genes function as checkpoints for the maintenance of VSMC contractile phenotype and prevent pathological remodeling in arterial diseases; Authors - Yunchang Liu 刘运畅
human	IF	Cardiovasc Diabetol; Non-coding RNA-mediated endothelial-to-mesenchymal transition in human diabetic cardiomyopathy, potential regulation by DNA methylation; Authors - Eric Wang
mouse	WB	Genes Dis; Macrophage κ-opioid receptor inhibits hypoxic pulmonary hypertension progression and right heart dysfunction via an SCD1-dependent anti-inflammatory response.; Authors - Qiaojuan Wang

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Ana Luísa (Verified Customer) (07-25-2022)

No permeabilization. Blocking with 5%FBS and 2%BSA. Some background

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Intervertebral disc cells