TAOK1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAOK1 Polyclonal antibody, PBS Only (26250-1-PBS)

• 

  WB analysis of HeLa using 26250-1-AP (same clone as 26250-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 26250-1-AP (TAOK1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 26250-1-AP (same clone as 26250-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 26250-1-AP (TAOK1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 26250-1-AP (same clone as 26250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26250-1-AP (TAOK1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 26250-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 26250-1-AP (same clone as 26250-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26250-1-AP (TAOK1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 26250-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 26250-1-AP (same clone as 26250-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 26250-1-AP (TAOK1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26250-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAOK1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 26250-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

26250-1-PBS targets TAOK1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22461

  Product name: Recombinant human TAOK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 890-1001 aa of BC133039

  Sequence: MVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT

• Full Name: TAO kinase 1
• Calculated Molecular Weight: 1001 aa, 116 kDa
• Observed Molecular Weight: 116 kDa
• GenBank Accession Number: BC133039
• Gene Symbol: TAOK1
• Gene ID (NCBI): 57551
• RRID: AB_2880446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L7X3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thousand and one kinase 1 (TAOK1), also known as prostate-derived sterile 20 (Ste20)-like kinase 2, TAO1 (thousand and one amino-acid protein 1) or MARKK, is a member of the MAP3K protein kinase and belongs to the germinal-center kinase-like class of sterile 20 (Ste20)-like kinases (PMID: 29400705). TAOK1 is involved in mammalian brain development and functions as a negative regulator in IL-17-mediated signaling and inflammation (PMID: 33565190). TAOK1 has a calculated molecular mass of 116 kDa and encodes a serine/threonine protein kinase at its N terminus.