CoraLite® Plus 488-conjugated TAU Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated TAU Monoclonal antibody (CL488-66499)

• 

  IF Staining of mouse brain using CL488-66499

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 488 TAU antibody (CL488-66499, Clone: 1E9A8 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TAU Monoclonal Antibody for IF-P

Cat No. CL488-66499

Clone No.1E9A8

Host / Isotype

Mouse / IgG2c

Reactivity

human, mouse, rat, pig

Applications

IF-P

Synonyms

MAPT, 1E9A8, AT180, DDPAC, MAPTL

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66499 targets TAU in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21926

  Product name: Recombinant human TAU protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 5-208 aa of BC000558

  Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL

• Full Name: microtubule-associated protein tau
• Calculated Molecular Weight: 37-46, 79-81 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC000558
• Gene Symbol: TAU
• Gene ID (NCBI): 4137
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10636
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The microtubule-associated protein TAU (MAPT or TAU) is encoded by MAPT gene, which locates on human chromosome 17q21, binds to the tubulin subunit of microtubule and promotes its assembly and stability. Most TAU is expressed in neurons, and TAU isoform is expressed in the peripheral nervous system while the others are expressed in the central nervous system. TAU links axonal microtubules with C-terminus to neural plasma membrane components with its N-terminus, suggesting the participation in intracellular signal transduction and neuron's development and viability.