TAX1BP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAX1BP1 Polyclonal antibody, PBS Only (14424-1-PBS)

• 

  WB analysis using 14424-1-AP (same clone as 14424-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14424-1-AP (TAX1BP1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14424-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 14424-1-AP (same clone as 14424-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14424-1-AP (TAX1BP1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14424-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14424-1-AP (same clone as 14424-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TAX1BP1 antibody (14424-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 14424-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TAX1BP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14424-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

TRAF6-binding protein, Tax1-binding protein 1, T6BP, PRO0105

---

Product Information

14424-1-PBS targets TAX1BP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5789

  Product name: Recombinant human TAX1BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 454-789 aa of BC050358

  Sequence: KECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

• Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 1
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC050358
• Gene Symbol: TAX1BP1
• Gene ID (NCBI): 8887
• RRID: AB_2198921
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAX1BP1 (also named as T6BP and TXBP151) inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. It is degraded by caspase-3-like family proteins upon TNF-induced apoptosis. TAX1BP1 may also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. TAX1BP1 binds TRAF6 but not TRAFs 1-5.