Product Information
12304-1-PBS targets TBCA in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2950 Product name: Recombinant human TBCA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC018210 Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA Predict reactive species |
| Full Name | tubulin folding cofactor A |
| Calculated Molecular Weight | 108 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC018210 |
| Gene Symbol | TBCA |
| Gene ID (NCBI) | 6902 |
| RRID | AB_2199402 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75347 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







