TBCA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TBCA Polyclonal antibody, PBS Only (12304-1-PBS)

• 

  WB analysis of human brain using 12304-1-AP (same clone as 12304-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12304-1-AP (TBCA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12304-1-AP (same clone as 12304-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12304-1-AP (TBCA Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12304-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 12304-1-AP (same clone as 12304-1-PBS)

  IP result of anti-TBCA (IP:12304-1-AP, 4ug; Detection:12304-1-AP 1:300) with HeLa cells lysate 2920 ug. This data was developed using the same antibody clone with 12304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 12304-1-AP (same clone as 12304-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 12304-1-AP (TBCA antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12304-1-PBS in a different storage buffer formulation.

TBCA Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12304-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12304-1-PBS targets TBCA in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2950

  Product name: Recombinant human TBCA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-108 aa of BC018210

  Sequence: MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

• Full Name: tubulin folding cofactor A
• Calculated Molecular Weight: 108 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC018210
• Gene Symbol: TBCA
• Gene ID (NCBI): 6902
• RRID: AB_2199402
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75347
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.