CoraLite® Plus 488-conjugated TCB1 Recombinant monoclonal antibody

• 

  IF Staining of mouse thymus using CL488-84878-5

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse thymus tissue using CoraLite® Plus 488 TCB1 antibody (CL488-84878-5, Clone: 241802B12 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TCB1 Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-84878-5

Clone No.241802B12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF-P

Synonyms

---

Tested Applications

• Positive IF-P detected in: mouse thymus tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84878-5 targets TCB1 in IF-P applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2437

  Product name: Recombinant Mouse TCB1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-140 aa of

  Sequence: EDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYQQGVLS

• Full Name: TCB1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 38 kDa
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01852
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.