TCEAL7 Polyclonal antibody, PBS Only

• 

  WB analysis of human liver using 11218-1-AP (same clone as 11218-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11218-1-AP (TCEAL7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 11218-1-AP (same clone as 11218-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 11218-1-AP (TCEAL7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11218-1-AP (same clone as 11218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11218-1-AP (TCEAL7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11218-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11218-1-AP (same clone as 11218-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11218-1-AP (TCEAL7 antibody) at dilution of 1:50 (under 25x lens). This data was developed using the same antibody clone with 11218-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TCEAL7 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11218-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11218-1-PBS targets TCEAL7 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1715

  Product name: Recombinant human TCEAL7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC016786

  Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

• Full Name: transcription elongation factor A (SII)-like 7
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC016786
• Gene Symbol: TCEAL7
• Gene ID (NCBI): 56849
• RRID: AB_2201131
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BRU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines