TCF3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67140-1-Ig (same clone as 67140-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 67140-1-Ig (same clone as 67140-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67140-1-Ig (same clone as 67140-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67140-1-Ig (same clone as 67140-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 67140-1-Ig (same clone as 67140-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67140-1-Ig (same clone as 67140-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NCI-H1299 using 67140-1-Ig (same clone as 67140-1-PBS)

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 67140-1-Ig (same clone as 67140-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67140-1-Ig (same clone as 67140-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67140-1-Ig (same clone as 67140-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67140-1-Ig (TCF3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67140-1-Ig (same clone as 67140-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TCF3 antibody (67140-1-Ig, Clone: 1D12E5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67140-1-Ig (same clone as 67140-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67140-1-Ig (TCF3 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67140-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TCF3 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67140-1-PBS

Clone No.1D12E5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

bHLHb21, E2A, ITF1, Kappa E2 binding factor, TCF 3, TCF3, Transcription factor 3, Transcription factor E2 alpha, Transcription factor ITF 1

---

Product Information

67140-1-PBS targets TCF3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15734

  Product name: Recombinant human TCF3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 318-480 aa of BC110580

  Sequence: WPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQ

• Full Name: transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
• Calculated Molecular Weight: 654 aa, 68 kDa
• Observed Molecular Weight: 68-70 kDa
• GenBank Accession Number: BC110580
• Gene Symbol: TCF3
• Gene ID (NCBI): 6929
• RRID: AB_2882439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15923
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.