TCL1A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Ramos using 85129-5-RR (same clone as 85129-5-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 85129-5-RR (TCL1A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85129-5-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 85129-5-RR (same clone as 85129-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 85129-5-RR (TCL1A antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85129-5-PBS in a different storage buffer formulation.

• 

  IF Staining of Ramos using 85129-5-RR (same clone as 85129-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Ramos cells using TCL1A antibody (85129-5-RR, Clone: 242623A9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85129-5-PBS in a different storage buffer formulation.

• 

  FC experiment of Ramos using 85129-5-RR (same clone as 85129-5-PBS)

  1x10^6 Ramos cells were intracellularly stained with 0.25 ug TCL1A Recombinant antibody (85129-5-RR, Clone:242623A9) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 85129-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85129-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85129-5-RR against Human TCL1A were performed. The affinity constant is 0.185 nM.

TCL1A Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85129-5-PBS

Clone No.242623A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

242623A9, Oncogene TCL-1, T-cell leukemia/lymphoma protein 1A, TCL1

---

Product Information

85129-5-PBS targets TCL1A in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0786

  Product name: Recombinant human TCL1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-114 aa of BC005831

  Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

• Full Name: T-cell leukemia/lymphoma 1A
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC005831
• Gene Symbol: TCL1A
• Gene ID (NCBI): 8115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56279
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TCL1A, also named as TCL1 and p14 TCL1, enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. TCL1A immunodetection is an independent marker of adverse outcome that could be used in routine settings for the management of DLCL patients. TCL1A expression is correlated with shorter time to treatment in chronic lymphocytic leukemia cases and shorter lymphoma-specific survival in mantle cell lymphoma series. It is a potential therapeutic target.