TDG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TDG Polyclonal antibody, PBS Only (13370-1-PBS)

• 

  WB analysis using 13370-1-AP (same clone as 13370-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13370-1-AP (same clone as 13370-1-PBS)

  WB result of TDG antibody (13370-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TDG transfected HEK-293 cells. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13370-1-AP (same clone as 13370-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 13370-1-AP (same clone as 13370-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13370-1-AP (same clone as 13370-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 13370-1-AP (same clone as 13370-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 13370-1-AP (same clone as 13370-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 13370-1-AP (TDG antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  IP experiment of U-937 using 13370-1-AP (same clone as 13370-1-PBS)

  IP result of anti-TDG (IP:13370-1-AP, 3ug; Detection:13370-1-AP 1:400) with U-937 cells lysate 3000ug. This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13370-1-AP (same clone as 13370-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 13370-1-AP (TDG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13370-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TDG Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 13370-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

EC:3.2.2.29, G/T mismatch-specific thymine DNA glycosylase, hTDG, thymine DNA glycosylase, Thymine-DNA glycosylase

---

Product Information

13370-1-PBS targets TDG in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4190

  Product name: Recombinant human TDG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-410 aa of BC037557

  Sequence: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

• Full Name: thymine-DNA glycosylase
• Calculated Molecular Weight: 410 aa, 46 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC037557
• Gene Symbol: TDG
• Gene ID (NCBI): 6996
• RRID: AB_2271704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13569
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TDG belongs to the TDG/mug DNA glycosylase family. TDG corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine. RNF4 interacts with and requires the base excision repair enzymes TDG and APE1 for active demethylation (PMID:20696907). TDG is modified by SUMO-1 and SUMO-2/3.The molecular weight of non-modified TDG is 46 kDa and modified TDG is 55-60 kDa.