• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TDP-43 Recombinant monoclonal antibody

TDP-43 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-80001
Clone No.11N20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TDP-43 (N-terminal), TDP-43(N-terminal), TARDBP, TDP 43, TDP43

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80001 targets TDP-43 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1231

Product name: Recombinant human TDP-43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-260 aa of BC001487

Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA

Predict reactive species
Full Name TAR DNA binding protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC001487
Gene Symbol TDP-43
Gene ID (NCBI) 23435
RRIDAB_3084483
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13148
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene. In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS). Proteintech's 80001-1-RR is a rabbit recombinant TDP-43 antibody recognizing N-terminal TDP-43. It recognizes the intact 43 kDa protein as well as all posttranslationally modified and truncated forms in multiple applications. Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659, 19823856, 21666678, 22193176) Recently TDP-43 has been reported to be overexpressed in triple negative breast cancer (TNBC) and it may be a potential target for TNBC diagnosis and drug design. (PMID: 29581274).

80001-1-RR can be used in WB, IHC, IHF. For the ICC (IF with cells) experiment, the results will be better with ethanol fixed cell and dilution 1:50 or 1:100. Another antibody with CatNo. 80002-1-RR is recommended for IF or ICC experiment.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TDP-43 antibody CL488-80001Download protocol
IF protocol for CL Plus 488 TDP-43 antibody CL488-80001Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...