CoraLite® Plus 488-conjugated TEAD4 Recombinant monoclonal antibody

TEAD4 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84932-4
Clone No.242496B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

242496B2, EFTR 2, hRTEF 1B, RTEF1, TCF13L1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84932-4 targets TEAD4 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3059

Product name: Recombinant human TEAD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 135-434 aa of BC015497

Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Predict reactive species
Full Name TEA domain family member 4
Calculated Molecular Weight 434 aa, 48 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC015497
Gene Symbol TEAD4
Gene ID (NCBI) 7004
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15561
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TEAD4 belongs to a protein family that shares the TEA/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins, a TBP-associated factor, and a limiting transcriptional intermediary factor. TEAD4 also performs an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration, and epithelial-mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but the molecular weight of TEAD4 is detected at about 50-55 kDa.

Loading...
||
New chat Able
正在加载,请稍候...