TEM1/CD248 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87247-1-RR (same clone as 87247-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87247-1-RR (CD248 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87247-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 87247-1-RR (same clone as 87247-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using TEM1 antibody (87247-1-RR, Clone: 251338A5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87247-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 87247-1-RR (same clone as 87247-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using TEM1 antibody (87247-1-RR, Clone: 251338A5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87247-1-PBS in a different storage buffer formulation.

TEM1/CD248 Uni-rAb^® Recombinant Antibody for WB, IF-P, Indirect ELISA

Cat No. 87247-1-PBS

Clone No.251338A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

CD248, TEM1, CD164L1, CD248 molecule, endosialin, Endosialin

---

Product Information

87247-1-PBS targets TEM1/CD248 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4427

  Product name: recombinant human CD248 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-360 aa of BC051340

  Sequence: QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA

• Full Name: CD248 molecule, endosialin
• Calculated Molecular Weight: 757 aa, 81 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC051340
• Gene Symbol: TEM1
• Gene ID (NCBI): 57124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCU0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant diseases. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa.