TEM1/CD248 Recombinant monoclonal antibody

• 

  WB analysis using 87247-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87247-1-RR (CD248 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of human placenta using 87247-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using TEM1 antibody (87247-1-RR, Clone: 251338A5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 87247-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using TEM1 antibody (87247-1-RR, Clone: 251338A5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TEM1/CD248 Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 87247-1-RR

Clone No.251338A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, ELISA

Synonyms

CD248, TEM1, CD164L1, CD248 molecule, endosialin, Endosialin

---

Tested Applications

• Positive WB detected in: HUVEC cells, COLO 205 cells, A2780 cells, U2OS cells, Caco-2 cells, NIH/3T3 cells, bEnd.3 cells
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87247-1-RR targets TEM1/CD248 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4427

  Product name: recombinant human CD248 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-360 aa of BC051340

  Sequence: QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA

• Full Name: CD248 molecule, endosialin
• Calculated Molecular Weight: 757 aa, 81 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC051340
• Gene Symbol: TEM1
• Gene ID (NCBI): 57124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCU0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant diseases. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa.