CoraLite® Plus 488-conjugated TFF2 Monoclonal antibody

TFF2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-66471
Clone No.2D7B1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

SML1, 2D7B1, SP, Spasmolysin, Spasmolytic polypeptide

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66471 targets TFF2 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18765

Product name: Recombinant human TFF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-129 aa of BC032820

Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Predict reactive species
Full Name trefoil factor 2
Calculated Molecular Weight 129 aa, 14 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC032820
Gene Symbol TFF2
Gene ID (NCBI) 7032
RRIDAB_2934464
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ03403
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TFF2 antibody CL488-66471Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...