TFPI Recombinant monoclonal antibody

• 

  WB analysis of HepG2 using 83838-5-RR

  HepG2 cells were subjected to SDS PAGE followed by western blot with 83838-5-RR (TFPI antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 83838-5-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TFPI antibody (83838-5-RR, Clone: 240977B1 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of HepG2 using 83838-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug TFPI Recombinant antibody (83838-5-RR, Clone:240977B1) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of HUVEC using 83838-5-RR

  1x10^6 HUVEC cells were surface stained with 0.25 ug TFPI Recombinant antibody (83838-5-RR, Clone:240977B1) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 83838-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83838-5-RR against Human TFPI were performed. The affinity constant is below 1 pM.

TFPI Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83838-5-RR

Clone No.240977B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

240977B1, EPI, Extrinsic pathway inhibitor, LACI, Lipoprotein-associated coagulation inhibitor

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83838-5-RR targets TFPI in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0855

  Product name: Recombinant Human TFPI protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 29-282 aa of NM_006287.6

  Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

• Full Name: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_006287.6
• Gene Symbol: TFPI
• Gene ID (NCBI): 7035
• RRID: AB_3671421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P10646-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tissue factor pathway inhibitor (TFPI) is a critical anticoagulant protein present in endothelium and platelets. TFPI is produced as two major isoforms in humans, TFPIa and TFPIb that result from alternative splicing. The TFPIb isoform localizes to the endothelium surface where it is a potent inhibitor of tissue factor-factor VIIa complexes that initiate blood coagulation. The TFPIa isoform is present in platelets. TFPI is a Kunitz-type serine protease inhibitor that exerts anticoagulant activity by blocking early procoagulant stimulia. TFPI can enhance anti-thrombotic treatment in sepsis, inflammatory diseases, and cardiovascular diseases.