CoraLite® Plus 488-conjugated TFPI Recombinant monoclonal antibody

TFPI Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83838-5
Clone No.240977B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240977B1, EPI, Extrinsic pathway inhibitor, LACI, Lipoprotein-associated coagulation inhibitor

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83838-5 targets TFPI in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0855

Product name: Recombinant Human TFPI protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-10*His

Domain: 29-282 aa of NM_006287.6

Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK

Predict reactive species
Full Name tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
Calculated Molecular Weight35 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberNM_006287.6
Gene Symbol TFPI
Gene ID (NCBI) 7035
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10646-1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Tissue factor pathway inhibitor (TFPI) is a critical anticoagulant protein present in endothelium and platelets. TFPI is produced as two major isoforms in humans, TFPIa and TFPIb that result from alternative splicing. The TFPIb isoform localizes to the endothelium surface where it is a potent inhibitor of tissue factor-factor VIIa complexes that initiate blood coagulation. The TFPIa isoform is present in platelets. TFPI is a Kunitz-type serine protease inhibitor that exerts anticoagulant activity by blocking early procoagulant stimulia. TFPI can enhance anti-thrombotic treatment in sepsis, inflammatory diseases, and cardiovascular diseases.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TFPI antibody CL488-83838-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...