Use Able AI chat for product recommendations

CoraLite® Plus 488 Anti-Human TGFBR2 Rabbit Recombinant Antibody

TGFBR2 Uni-rAb® Recombinant Antibody for FC

Cat No. CL488-98438
Clone No.250238A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II, TGF-beta receptor type-2

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98438 targets TGFBR2 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2943

Product name: Recombinant Human TGFBR2 protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 23-159 aa of NM_003242.5

Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Predict reactive species
Full Name transforming growth factor, beta receptor II (70/80kDa)
Calculated Molecular Weight65 kDa
GenBank Accession NumberNM_003242.5
Gene Symbol TGFBR2
Gene ID (NCBI) 7048
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37173-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 is a serine/threonine kinase and the primary ligand-binding receptor. After binding of the ligand TGF-β1, TGFBR2 forms a heterodimer complex with TGFBR1, causing conformational changes and signal propagation via canonical (SMAD-dependent) and non-canonical (SMAD-independent) routes. Upon translocation into the nucleus, activated SMAD complexes can interact with various transcription factors to control target gene expression (PMID: 31454892).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TGFBR2 antibody CL488-98438Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...