CoraLite® Plus 647 Anti-Human TGFBR2 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using CL647-98438

  1x10^6 human PBMCs were surface stained with CoraLite® Plus 488 Anti-Human CD3, and 5 ul CoraLite® Plus 647 Anti-Human TGFBR2 Rabbit RecAb (CL647-98438, Clone: 250238A7) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9). Cells were not fixed. Lymphocytes were gated.

• 

  FC experiment of human PBMCs using CL647-98438

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 647 Anti-Human TGFBR2 Rabbit RecAb (CL647-98438, Clone: 250238A7) (red) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9) (blue). Cells were not fixed. Lymphocytes were gated.

TGFBR2 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL647-98438

Clone No.250238A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II, TGF-beta receptor type-2

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98438 targets TGFBR2 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2943

  Product name: Recombinant Human TGFBR2 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-159 aa of NM_003242.5

  Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

• Full Name: transforming growth factor, beta receptor II (70/80kDa)
• Calculated Molecular Weight: 65 kDa
• GenBank Accession Number: NM_003242.5
• Gene Symbol: TGFBR2
• Gene ID (NCBI): 7048
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37173-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 is a serine/threonine kinase and the primary ligand-binding receptor. After binding of the ligand TGF-β1, TGFBR2 forms a heterodimer complex with TGFBR1, causing conformational changes and signal propagation via canonical (SMAD-dependent) and non-canonical (SMAD-independent) routes. Upon translocation into the nucleus, activated SMAD complexes can interact with various transcription factors to control target gene expression (PMID: 31454892).