CoraLite®594-conjugated TH1L Monoclonal antibody

• 

  IF Staining of HeLa using CL594-67380

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite®594 TH1L antibody (CL594-67380, Clone: 1A10G2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-67380

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite®594 Anti-Human TH1L (CL594-67380, Clone:1A10G2) (red), or 0.8 ug CoraLite®594 Mouse IgG2a Isotype Control (C1.18.4) (CL594-65208, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

TH1L Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67380

Clone No.1A10G2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67380 targets TH1L in IF/ICC, FC (Intra) applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24894

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-590 aa of BC014952

  Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_3084762
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.