TH1L Monoclonal antibody

• 

  WB analysis using 67380-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of Jurkat using 67380-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 67380-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67380-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67380-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 67380-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67380-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67380-1-Ig (TH1L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 67380-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 67380-1-Ig (TH1L antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67380-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of HeLa using 67380-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TH1L antibody (67380-1-Ig, Clone: 1A10G2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HeLa using 67380-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human TH1L (67380-1-Ig, Clone:1A10G2) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

TH1L Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67380-1-Ig

Clone No.1A10G2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells, MCF-7 cells, HeLa cells, HepG2 cells
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67380-1-Ig targets TH1L in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24894

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-590 aa of BC014952

  Sequence: QAMMSVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_2882627
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.