CoraLite® Plus 488-conjugated CD141/Thrombomodulin Monoclonal antibody

• 

  IF Staining of human lung cancer using CL488-67831

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using CoraLite® Plus 488 THBD antibody (CL488-67831, Clone: 5A4C5 ) at dilution of 1:200.

• 

  IF Staining of human lung cancer using CL488-67831

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using CoraLite® Plus 488 THBD antibody (CL488-67831, Clone: 5A4C5 ) at dilution of 1:200.

CD141/Thrombomodulin Monoclonal Antibody for IF-P

Cat No. CL488-67831

Clone No.5A4C5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF-P

Synonyms

THBD, Thrombomodulin, THRM, Fetomodulin, CD141

---

Tested Applications

• Positive IF-P detected in: human lung cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67831 targets CD141/Thrombomodulin in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5723

  Product name: Recombinant human THBD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-350 aa of BC035602

  Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH

• Full Name: thrombomodulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC035602
• Gene Symbol: THBD
• Gene ID (NCBI): 7056
• RRID: AB_2934572
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07204
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Thrombomodulin, also known as CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310).