Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated CD141/Thrombomodulin Monoclonal antibody

CD141/Thrombomodulin Monoclonal Antibody for IF-P

Cat No. CL488-67831
Clone No.5A4C5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF-P

THBD, Thrombomodulin, THRM, Fetomodulin, CD141

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman lung cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67831 targets CD141/Thrombomodulin in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5723

Product name: Recombinant human THBD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 18-350 aa of BC035602

Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH

Predict reactive species
Full Name thrombomodulin
Calculated Molecular Weight 60 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC035602
Gene Symbol THBD
Gene ID (NCBI) 7056
RRIDAB_2934572
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07204
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Thrombomodulin, also known as CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD141/Thrombomodulin antibody CL488-67831Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...