TIMM17B Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 11062-1-AP (same clone as 11062-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11062-1-AP (TIMM17B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11062-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 11062-1-AP (same clone as 11062-1-PBS)

  WB result of TIMM17B antibody (11062-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TIMM17B transfected PC-3 cells. This data was developed using the same antibody clone with 11062-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11062-1-AP (same clone as 11062-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11062-1-AP (TIMM17B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11062-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 11062-1-AP (same clone as 11062-1-PBS)

  IP result of anti-TIMM17B (IP:11062-1-AP, 4ug; Detection:11062-1-AP 1:1000) with PC-3 cells lysate 1575 ug. This data was developed using the same antibody clone with 11062-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 11062-1-AP (same clone as 11062-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11062-1-AP (TIMM17B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11062-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TIMM17B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11062-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

DXS9822, JM3, Mitochondrial import inner membrane translocase subunit Tim17-B, TIM17B

---

Product Information

11062-1-PBS targets TIMM17B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1504

  Product name: Recombinant human TIMM17B protein

  Source: e coli.-derived, PKG

  Tag: GST

  Domain: 1-172 aa of BC010142

  Sequence: MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH

• Full Name: translocase of inner mitochondrial membrane 17 homolog B (yeast)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC010142
• Gene Symbol: TIMM17B
• Gene ID (NCBI): 10245
• RRID: AB_2201995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.