TM6SF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TM6SF2 Polyclonal antibody, PBS Only (27671-1-PBS)

• 

  WB analysis using 27671-1-AP (same clone as 27671-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27671-1-AP (TM6SF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27671-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27671-1-AP (same clone as 27671-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27671-1-AP (TM6SF2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27671-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 27671-1-AP (same clone as 27671-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27671-1-AP (TM6SF2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27671-1-PBS in a different storage buffer formulation.

TM6SF2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27671-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

KIAA1926, Transmembrane 6 superfamily member 2

---

Product Information

27671-1-PBS targets TM6SF2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26527

  Product name: Recombinant human TM6SF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 289-377 aa of NM_001001524

  Sequence: MFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVPEDTWGCFFVCNLLYALGPHLLAYRCLQWPAFFHQPPPSDPLALHKKQH

• Full Name: transmembrane 6 superfamily member 2
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: NM_001001524
• Gene Symbol: TM6SF2
• Gene ID (NCBI): 533
• RRID: AB_3085983
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZW4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TM6SF2 is mainly expressed in the liver, intestine, kidney, and in other tissues at low levels. In terms of subcellular localization, TM6SF2 is localized in the endoplasmic reticulum (ER), the ER-Golgi intermediate compartment, and Golgi of liver cells and enterocytes. The loss of TM6SF2 promotes the release of free fatty acids from IECs, leading to intestinal barrier dysfunction, gut microbiota dysbiosis and metabolite alterations (PMID: 29232562, 27013658). TM6SF2 encodes a protein predicted to have 7-10 transmembrane domains, containing 351 amino acids (39.5-kDa) with an estimated isoelectric point (pI) of 8.29 (PMID: 39779889).