TMOD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMOD1 Polyclonal antibody, PBS Only (10145-1-PBS)

• 

  WB analysis using 10145-1-AP (same clone as 10145-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10145-1-AP (TMOD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10145-1-AP (same clone as 10145-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10145-1-AP (TMOD1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 10145-1-AP (same clone as 10145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10145-1-AP (TMOD1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 10145-1-AP (same clone as 10145-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10145-1-AP (TMOD1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 10145-1-AP (same clone as 10145-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using TMOD1 antibody (10145-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 10145-1-AP (same clone as 10145-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using TMOD1 antibody (10145-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10145-1-PBS in a different storage buffer formulation.

TMOD1 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 10145-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

D9S57E, E-Tmod, TMOD, tropomodulin 1, Tropomodulin-1

---

Product Information

10145-1-PBS targets TMOD1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0192

  Product name: Recombinant human TMOD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-359 aa of BC002660

  Sequence: PVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV

• Full Name: tropomodulin 1
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC002660
• Gene Symbol: TMOD1
• Gene ID (NCBI): 7111
• RRID: AB_2205316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28289
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Actin filaments control cell morphology. The length of these filaments is regulated in muscle and nonmuscle cell types by tropomodulins 1-4 (Tmod1-4), a family of proteins that cap the pointed ends of actin filaments. The molecular weight of Tmod 1 is about 40 kDa.