Tested Applications
| Positive WB detected in | Caco-2 cells, HeLa cells, SCaBER cells, LNCaP cells, HEK-293 cells, Jurkat cells, HuT 78 cells, HSC-T6 cells, 4T1 cells, HepG2 cells |
| Positive IHC detected in | rat kidney tissue, human thyroid cancer tissue, mouse kidney tissue, rat ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66695-1-Ig targets TNFAIP3 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18150 Product name: Recombinant human TNFAIP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 441-790 aa of BC114480 Sequence: EAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG Predict reactive species |
| Full Name | tumor necrosis factor, alpha-induced protein 3 |
| Calculated Molecular Weight | 790 aa, 90 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC114480 |
| Gene Symbol | TNFAIP3 |
| Gene ID (NCBI) | 7128 |
| RRID | AB_2882048 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P21580 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNFAIP3, also named A20, is a cytoplasmic zinc finger protein that inhibits nuclear factor kappa-B (NFKB) activity and tumor necrosis factor (TNF)-mediated programmed cell death. A20 is a ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities, and involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TNFAIP3 antibody 66695-1-Ig | Download protocol |
| IF protocol for TNFAIP3 antibody 66695-1-Ig | Download protocol |
| IHC protocol for TNFAIP3 antibody 66695-1-Ig | Download protocol |
| WB protocol for TNFAIP3 antibody 66695-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-TNFAIP3 (A20), catalog number 66695-1-Ig, has 11 total citations published in journals including Immunity, Biomaterials, Cell Death & Disease, Science of the Total Environment, Chinese Medicine, Investigative Ophthalmology & Visual Science, BMC Biology, mBio, BBA Molecular Basis of Disease, Biology, and PLoS ONE. Associated research fields encompass cancer, inflammation, viral infection, lipid metabolism, ferroptosis, PANoptosis, gut microecology, and neuroprotection.
| Species | Application | Title |
|---|---|---|
Immunity Integrated computational analysis identifies therapeutic targets with dual action in cancer cells and T cells | ||
Biomaterials A pH/ROS dual-responsive metal-polyphenol-antibiotic nano-assembly for combating persistent infection by overcoming biofilm and cell membrane barriers. | ||
Cell Death Dis A20 targets PFKL and glycolysis to inhibit the progression of hepatocellular carcinoma. | ||
Sci Total Environ Alpha-ketoglutarate alleviates cadmium-induced inflammation by inhibiting the HIF1A-TNFAIP3 pathway in hepatocytes | ||
Chin Med Atractylodis Macrocephalae Rhizoma ameliorates diarrhea induced by cold drinks and a high-fat diet by remodeling gut microecology and restoring barrier function. | ||
Invest Ophthalmol Vis Sci Global MicroRNA Profiling of HSV-1 Infected Cornea Identifies miR-329 as a Novel Regulator of Virus Infection |
Reviews
What customers say
The single review for 66695-1-Ig is a 5-star rating from Jackie Gini (December 2025), who used the antibody for immunoprecipitation. They describe it as a strong choice for labs investigating TNFAIP3's role in NF-κB regulation and inflammatory signaling, highlighting its robust validation data and compatibility across standard cell biology workflows.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
jackie (Verified Customer) (12-11-2025) | This antibody is a strong choice for labs investigating TNFAIP3’s role in NF-κB regulation and inflammatory signaling, with robust validation data and compatibility across standard cell biology workflows.
|
