CoraLite®594-conjugated TNFAIP3 Monoclonal antibody

TNFAIP3 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-66695
Clone No.3A11G6

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

A20, A20p37, A20p50, EC:2.3.2.-, OTU domain-containing protein 7C

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66695 targets TNFAIP3 in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18150

Product name: Recombinant human TNFAIP3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 441-790 aa of BC114480

Sequence: EAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG

Predict reactive species
Full Name tumor necrosis factor, alpha-induced protein 3
Calculated Molecular Weight 790 aa, 90 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC114480
Gene Symbol TNFAIP3
Gene ID (NCBI) 7128
RRIDAB_2883615
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP21580
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TNFAIP3, also named A20, is a cytoplasmic zinc finger protein that inhibits nuclear factor kappa-B (NFKB) activity and tumor necrosis factor (TNF)-mediated programmed cell death. A20 is a ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities, and is involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity.

Protocols

Product Specific Protocols
FC protocol for CL594 TNFAIP3 antibody CL594-66695Download protocol
IF protocol for CL594 TNFAIP3 antibody CL594-66695Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...